SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2QVM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2QVM3
Domain Number 1 Region: 186-471
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.25e-108
Family Enolase 0.0000000842
Further Details:      
 
Domain Number 2 Region: 47-182
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.86e-53
Family Enolase N-terminal domain-like 0.00000482
Further Details:      
 
Weak hits

Sequence:  A0A0B2QVM3
Domain Number - Region: 3-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0165
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B2QVM3
Sequence length 473
Comment (tr|A0A0B2QVM3|A0A0B2QVM3_GLYSO) Cytosolic enolase 3 {ECO:0000313|EMBL:KHN23808.1} KW=Complete proteome; Reference proteome OX=3848 OS=Glycine soja (Wild soybean). GN=glysoja_028101 OC=Phaseoleae; Glycine; Soja.
Sequence
MSVQDYLDKHMLSRKLEDAVNAAVRAKTSDPVLFISNHMRKAVQSVITKIKARQILDSRG
IPTVEVDLHTNKGVFRASVPSGNSTSMYEAVELRDGDKGVYLGNGVAKAVKNINDKISEA
LIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSIAACKAGAAEKEVPLYKHIADLS
GKTSPTLPVPAFTVISGGKHAGSNLAIQEIMILPIGASKFEEALRMGTETYHHLKAVITE
KYGAHNCNVGEDGGFAPNISSFREALDLVKEAISRTGYNEKIKIALDVAATNFCIGKRYD
LDFQSPQKSGQNFKSAEDMIELFKELCSEYPIVSIEDPFDREDWEHIKHISSLGICQVVG
DDLLMSNAKRIERAITESACNALLLKVNQVGTVTEVIEVVKLAKEAHWGVVTSHRCGETI
DSFIADLSVGLASGVIKAGAPCRGERLEKYNQLLRIEEELGDQAVYASEDWRQ
Download sequence
Identical sequences A0A0B2QVM3 I1M6B8
XP_003544507.1.40590 Glyma14g01320.1|PACid:16293954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]