SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2QWH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2QWH3
Domain Number 1 Region: 5-92
Classification Level Classification E-value
Superfamily Cystatin/monellin 2.98e-29
Family Cystatins 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B2QWH3
Sequence length 103
Comment (tr|A0A0B2QWH3|A0A0B2QWH3_GLYSO) Cysteine proteinase inhibitor {ECO:0000256|RuleBase:RU362130} KW=Complete proteome; Reference proteome OX=3848 OS=Glycine soja (Wild soybean). GN=glysoja_038223 OC=Phaseoleae; Glycine; Soja.
Sequence
MAALGGFTDITGAQNSIDIENLARFAVDEHNKKENAVLEFVRVISAKKQVVSGTLYYITL
EANDGVTKKVYETKVLEKPWLNIKEVQEFKPITVAVNPLSVTV
Download sequence
Identical sequences A0A0B2QWH3 C6SV68
Glyma14g04250.1|PACid:16294312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]