SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2SAJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2SAJ2
Domain Number 1 Region: 128-171
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 0.000000222
Family Chlorophyll a-b binding protein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B2SAJ2
Sequence length 182
Comment (tr|A0A0B2SAJ2|A0A0B2SAJ2_GLYSO) Uncharacterized protein {ECO:0000313|EMBL:KHN41304.1} KW=Complete proteome; Reference proteome OX=3848 OS=Glycine soja (Wild soybean). GN=glysoja_030142 OC=Phaseoleae; Glycine; Soja.
Sequence
MSMACSIPCIKIPTCSSSPSCTSSSTSSYSLRFSSSKPHSVTIRNSQAEGPIRRPVAPPI
REPSSSSSSAPQLQKPTLPSQPPPSPSPPQKPATVVGDDKNVITLEFQRQKAKELQEYFK
QKKLEQADQGPFFGFIGKNEISNGRWAMFGFAVGLLTEYATGSDFVDQVKILLSNFGIVD
LE
Download sequence
Identical sequences A0A0B2SAJ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]