SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2SB69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2SB69
Domain Number 1 Region: 21-113
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000000178
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.045
Further Details:      
 
Domain Number 2 Region: 125-176
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.000000000255
Family Archaeal tRNA CCA-adding enzyme substrate-binding domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B2SB69
Sequence length 197
Comment (tr|A0A0B2SB69|A0A0B2SB69_GLYSO) DNA polymerase sigma {ECO:0000313|EMBL:KHN44001.1} KW=Complete proteome; Reference proteome OX=3848 OS=Glycine soja (Wild soybean). GN=glysoja_047998 OC=Phaseoleae; Glycine; Soja.
Sequence
MEAFSPFCKQVAAENMARRPYINWAVKRVTRFLQVLWPRSRTNIFGSNATGMSLPTSDVD
LVVCLPPVRNLEPIKEAGILEGRNGIKETCLQHAARYLANQDWVKNDSLKTVKNTAVKGL
TEQFPAATPLALVLKQFLADRSLDQSDSGGLSSYCLVLLIIRFLQHEHHLGWPINQVNLD
LSSYSYSSLYLLMAIED
Download sequence
Identical sequences A0A0B2SB69

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]