SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2T0J7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2T0J7
Domain Number 1 Region: 3-173
Classification Level Classification E-value
Superfamily RibA-like 1.83e-66
Family RibA-like 0.00000003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B2T0J7
Sequence length 197
Comment (tr|A0A0B2T0J7|A0A0B2T0J7_PECCA) GTP cyclohydrolase II {ECO:0000256|HAMAP-Rule:MF_00179} KW=Complete proteome OX=554 OS=Pectobacterium carotovorum (Erwinia carotovora). GN=OI69_14060 OC=Pectobacteriaceae; Pectobacterium.
Sequence
MQLKRVAEAKLPTPWGDFLMVGFEEMATGHDHLALVYGDISGSVPVLARVHSECLTGDAL
FSLRCDCGFQLEAALGHIAEEGRGVLLYHRQEGRNIGLLNKIRAYALQDLGADTVEANHQ
LGFAADERDFTLCADMFKLLGVDEVRLLTNNPQKVKILNEAGINIVERVPLIVGRNPKNE
NYLATKAAKMGHMLDIK
Download sequence
Identical sequences A0A0B2T0J7
WP_039351664.1.76911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]