SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2UHQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2UHQ7
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.000000000017
Family PSF3 N-terminal domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 68-153
Classification Level Classification E-value
Superfamily GINS helical bundle-like 0.0000022
Family PSF3 C-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B2UHQ7
Sequence length 156
Comment (tr|A0A0B2UHQ7|A0A0B2UHQ7_9MICR) Uncharacterized protein {ECO:0000313|EMBL:KHN68858.1} KW=Complete proteome; Reference proteome OX=1354746 OS=Ordospora colligata OC4. GN=M896_120800 OC=Eukaryota; Fungi; Microsporidia; Ordosporidae; Ordospora.
Sequence
MTYYDIDDIMLNEQKIPITFNHTVLNFGLLGSRACKTISAGKKVDAPYFLVGFLLRNGHC
NLSSEFNNEKVMEDIRAKPSAVDLRSVCPYFFYLHSILADSNALLAEFFYERIGDYSPLI
LKDTFSEDDVWKLEMTERQLIIRARRIFQRFKIFFM
Download sequence
Identical sequences A0A0B2UHQ7
XP_014562900.1.100427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]