SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2UJW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2UJW3
Domain Number 1 Region: 5-72
Classification Level Classification E-value
Superfamily Cap-Gly domain 5.89e-28
Family Cap-Gly domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B2UJW3
Sequence length 204
Comment (tr|A0A0B2UJW3|A0A0B2UJW3_9MICR) Subunit of dynactin complex {ECO:0000313|EMBL:KHN69544.1} KW=Complete proteome; Reference proteome OX=1354746 OS=Ordospora colligata OC4. GN=M896_060430 OC=Eukaryota; Fungi; Microsporidia; Ordosporidae; Ordospora.
Sequence
MVLLMLNDRLTLGDRFKGTVRYLGGIRTKEGKWVGLELDEPVGANDGSVNGVRYFDCKNK
HGIFVRYERIREGLVCEERGRAVDGSEMCDTKIGDYELKISELEKTIEQLKNTERREIAE
LRRELACLEGQRLQKNACYGVEEPRDINAAGLHTSHKKDENERRRVVYLVNRIMHGVLDE
EVDGMECLYKEFECIMKKNGILMD
Download sequence
Identical sequences A0A0B2UJW3
XP_014563586.1.100427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]