SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2URX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2URX9
Domain Number 1 Region: 59-102
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000116
Family MATH domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B2URX9
Sequence length 108
Comment (tr|A0A0B2URX9|A0A0B2URX9_TOXCA) Uncharacterized protein {ECO:0000313|EMBL:KHN71882.1} KW=Complete proteome; Reference proteome OX=6265 OS=Toxocara canis (Canine roundworm). GN=Tcan_01821 OC=Ascaridoidea; Toxocaridae; Toxocara.
Sequence
MEGSGGKVYASSHLYLHGNVECSPLGVKTQRYRGFQNPDVEARNDIEYVIQPTPIAGHKP
FLDRPISERNASFGAVRFCELNIAEKYIRDDVMFLKVDVENSKSLPFQ
Download sequence
Identical sequences A0A0B2URX9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]