SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2UTG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2UTG6
Domain Number 1 Region: 252-312
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000513
Family VWC domain 0.0058
Further Details:      
 
Domain Number 2 Region: 6-93
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000365
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 3 Region: 191-250
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000628
Family VWC domain 0.019
Further Details:      
 
Domain Number 4 Region: 345-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 319-359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000347
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B2UTG6
Sequence length 404
Comment (tr|A0A0B2UTG6|A0A0B2UTG6_TOXCA) Protein kinase C-binding protein NELL1 {ECO:0000313|EMBL:KHN72402.1} KW=Complete proteome; Reference proteome OX=6265 OS=Toxocara canis (Canine roundworm). GN=Tcan_12800 OC=Ascaridoidea; Toxocaridae; Toxocara.
Sequence
MGTSARNNRLFLKFRTRNGSIKTYALSAPLSDGKWHRIIFALSGDQIQLSENCHQLIRKQ
DFDLHFERRPHLRMFVGERTHHRRQFYGHMREFSADAGNPTFMKCPNLDLMLASPVVTSI
EETSTTTQQPLPYARTTVANELDERRSGLVDQTAFNQIVERVAFLEDQVRHWRAVIHSYD
SRLKTIELHQRGCQIDGRVISFGEKQQNLMNCTECQCSSSGELFCAAIGCPHLKCDHPIK
RVGQCCPECGKQCLYNGEYYQNGHEFWPKSCVRCACDDGRMECQFHQTHECPELDCYHQE
TPPNQCCPVCVGEDFCARNNPCHENADCINEKYGLKCKCKSGFFGNGTICYDIDECLWDE
SAREQLGGCKTGTICINLPGSFKCDCLPGFQKLDDKNCLDIIRV
Download sequence
Identical sequences A0A0B2UTG6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]