SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2V9I0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2V9I0
Domain Number 1 Region: 281-355
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.76e-16
Family DIX domain 0.015
Further Details:      
 
Domain Number 2 Region: 3-98
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000515
Family Regulator of G-protein signaling, RGS 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B2V9I0
Sequence length 360
Comment (tr|A0A0B2V9I0|A0A0B2V9I0_TOXCA) Axin-like protein 1 {ECO:0000313|EMBL:KHN80096.1} KW=Complete proteome; Reference proteome OX=6265 OS=Toxocara canis (Canine roundworm). GN=Tcan_06087 OC=Ascaridoidea; Toxocaridae; Toxocara.
Sequence
MAPPDERHRWSQKLENVLEDRDALEAFKRWMKAESPLVEHPINLHFAIIAYKNMCAAKNM
RAAELARNLHQKYVSINTGVCSFLQESRKCSAREVVKEVEPNAGEEEDELERYVRQRMAD
DSNKPSPSYHSPDSVNAHSLRFRRRSPKSSSPERFQYYTISPTMHSSYSGNPYGSNGFAP
PPCGRHAKQMNTASSKPVSRERCELKSMAIYDTSGIESMAPSSVSERDDAQRAAVFQKAR
LLSSGVAGGSSMRKSAHRHHDFSSLPRTRGGEAKPTMTISYKEKGRVPMVAHVPAHPITF
KEFRKYLGISSKCNLQFFFKTVCEDGSAPYQLLLVNDDSALLPIYEGRVTAECKSLSDSD
Download sequence
Identical sequences A0A0B2V9I0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]