SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2V9V1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2V9V1
Domain Number 1 Region: 556-697
Classification Level Classification E-value
Superfamily PX domain 7.19e-19
Family PX domain 0.0064
Further Details:      
 
Domain Number 2 Region: 272-405
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000191
Family Regulator of G-protein signaling, RGS 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B2V9V1
Sequence length 958
Comment (tr|A0A0B2V9V1|A0A0B2V9V1_TOXCA) Sorting nexin-14 {ECO:0000313|EMBL:KHN78303.1} KW=Complete proteome; Reference proteome OX=6265 OS=Toxocara canis (Canine roundworm). GN=Tcan_08560 OC=Ascaridoidea; Toxocaridae; Toxocara.
Sequence
MADGEFLWNFFEFLLGEPLTLKPPSKGMPCRISKDVGRKMPWEGVRIPESVNESLEELVE
QLIDSYINSWYKTEISNDTAYQIRYASAMAYRRIQKIDLSSLILSDAVPIAVVHAERVAR
IDAEIDKHVFPPQMVEMKILERMEDVHYALCSRQSEVNYLRQVADHLVAALIDESRVAGR
ASDDDSPLYSSNSLSNRSWPSHACRHFLRELIVFTFLIPILDLIADPDTINHLLILLFDP
EPMDMSAQPQPKMVELLHGLTDCALSGAPDSLLQLKLSEILRDSRQLNMFTMYLKDVRGP
TNELYFLLHSADVHERMLSIQKDDNALSELHYDVWEIFSKYVHGTAPERVALPEDVQSEF
QTAVETRAIEALDRAIEKAFQIVYKRLQHDFVVPFCQSECYLGHLCGSPPVSVDELMFVG
ERSSLGRRLTLPGTESSFSLSQFRNRLWKALMPSSVDGSVDSSFDRLSDLGSVRSGSPNI
QIELANDASAVAGSHPNPEYLVQFAPLPSIDVTCEEDPCTSTTEAISEVEVSPGSASNSE
ERIDRQSGCTSPYEMTMFDPHRDINRWMVTIPRIEPRRDPSNGRTMYVYIVCVERFDVND
NGSSNNGSHLCNETIHTNREWSVVRRYNEFYVLESKLLEFHGDLIKADPLPPRKPFATKS
RAFIETQRPHFARFLQLLTRQSVLKRSDLLFTFLTSDRELKDNMQLSDLNPWNVVRKMPS
KFTRERGQNLKPFLLSLLATTLAPQPEMGTMSFDTSRYSERSETSSMSSFSMEGARPRHL
LVNTIYGNNCPTAKADITNATVYIPWTKSLLDTLAFVFIRMFTIPRWFASLLISTRSLAA
HTLDAAVALLLRNVLRIAFLESNCVRMVRLIQDSLFAADQLPSTEQEKALRAELAQRRTL
EYLQEELPTHLLKAFGQKQFRQGVATLFRTLQYPRLNKQLSYVLLDVLVQKLLPVEQI
Download sequence
Identical sequences A0A0B2V9V1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]