SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2VNC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2VNC2
Domain Number 1 Region: 270-403
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.5e-39
Family Regulator of G-protein signaling, RGS 0.0000263
Further Details:      
 
Domain Number 2 Region: 19-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000037
Family DEP domain 0.02
Further Details:      
 
Domain Number 3 Region: 205-261
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000000112
Family Transducin (heterotrimeric G protein), gamma chain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B2VNC2
Sequence length 463
Comment (tr|A0A0B2VNC2|A0A0B2VNC2_TOXCA) Regulator of G-protein signaling 7 {ECO:0000313|EMBL:KHN85016.1} KW=Complete proteome; Reference proteome OX=6265 OS=Toxocara canis (Canine roundworm). GN=Tcan_11601 OC=Ascaridoidea; Toxocaridae; Toxocara.
Sequence
MAASTLAKLDSLSLRIAESAPLKTHKYFRVAVPQALTGQTLVAFLQELMAFDDPADALHL
ATLLLQHGYLFPVIEHSLVVKDDNTLYRLQLPYFWPSHATHTDNVEYAIYLNKRLMRNEQ
KHGLEEDEVEAYNKLLELLGHMWGFITVQAEMQLKMQKEKKKSDKVVYDSEERAFWRTRR
PGQANCLEQHVQKIEKKLRKCTAAGYKKELERLRFSLKTKPWLKALKASETMVSWCEQFH
DYDPFITAPQPSNPWISDDITLWVLNTDSVEVPTERRVKRWGLSVQELVRDPIGRQVLET
FLESEFSSENIRFWMAIQELKFASNENVDEKAQRIYEEFLATGAPCQVNVDSRTLENTLK
CLNDETVARRHAFSPAEEHVFTLMSKDSYPRFVRSQIYKGVLSAAQQQGSRRLGWRNFVF
NMGNQKKTPLTAKHKMSRDDNSHSSLPKQLSSDSLPVKTQTQR
Download sequence
Identical sequences A0A0B2VNC2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]