SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2VS45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2VS45
Domain Number 1 Region: 80-210
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.1e-26
Family Regulator of G-protein signaling, RGS 0.00057
Further Details:      
 
Domain Number 2 Region: 17-77
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000236
Family Regulator of G-protein signaling, RGS 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B2VS45
Sequence length 213
Comment (tr|A0A0B2VS45|A0A0B2VS45_TOXCA) Regulator of G-protein signaling rgs-3 {ECO:0000313|EMBL:KHN84129.1} KW=Complete proteome; Reference proteome OX=6265 OS=Toxocara canis (Canine roundworm). GN=Tcan_10371 OC=Ascaridoidea; Toxocaridae; Toxocara.
Sequence
MKDAKAKRKFVESFFEDYQPYLNIGAKALKKVKEAIQASDPDSSIFDQAVKEVEQMLEND
QFPRFKRSNLYMHYLEQLTSHSIALTWKNGINQLLCHQVGKHYFRLFLQRIRCEEKLRFL
EAASEFSLMDATTKALVYRGTQIFKQFILEGADEEVFLPFEVRNLIQEKLMQGRVDANLF
EEAIRYVATILKNDAYIRFLQSDEYRDLLARLK
Download sequence
Identical sequences A0A0B2VS45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]