SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2WTG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2WTG5
Domain Number 1 Region: 7-109
Classification Level Classification E-value
Superfamily Prefoldin 1.44e-24
Family Prefoldin 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B2WTG5
Sequence length 125
Comment (tr|A0A0B2WTG5|A0A0B2WTG5_9HYPO) Prefoldin {ECO:0000313|EMBL:KHN97328.1} KW=Complete proteome; Reference proteome OX=1081103 OS=Metarhizium album ARSEF 1941. GN=MAM_04925 OC=Metarhizium.
Sequence
MAETQAKLQALSDEYQKLQQDLQNTVNSRQKLQSQQQENAGVFKEFEKLGEDETIYKLMG
PVLLKQDRVEAESTVKGRLDFIAGEVSRLEGQIEETQGELEKKKAEIIHIQASAQAAASG
KAPQK
Download sequence
Identical sequences A0A0B2WTG5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]