SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2WWJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2WWJ9
Domain Number 1 Region: 98-207
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 2.88e-35
Family FAD-dependent thiol oxidase 0.0000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B2WWJ9
Sequence length 247
Comment (tr|A0A0B2WWJ9|A0A0B2WWJ9_9HYPO) Sulfhydryl oxidase {ECO:0000256|RuleBase:RU371123} KW=Complete proteome; Reference proteome OX=1081103 OS=Metarhizium album ARSEF 1941. GN=MAM_01375 OC=Metarhizium.
Sequence
MARRQHLVLVVILAIVALLGITYIHSASLVPRPADLFKPDRSEDVPSTAGGEEEPPASTG
SKSGTGFDLGAVPDLSKGDSIAPPLENATKKSVSPAAPCLAELGRATWKFLHTMVARFPE
KPTDSERKTLESFFHVFGLLYPCGDCARHFRGLLQKYPPQTSSRNAAQGWLCAVHNHVNK
RLNTDGQHPQFDCTKIGDAYDCGCGDDKKDTDEGEEDGKKSKVTRAERGHVAAPWPWKQW
TKAIEGL
Download sequence
Identical sequences A0A0B2WWJ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]