SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2X159 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2X159
Domain Number 1 Region: 57-88,199-272
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000013
Family Regulator of G-protein signaling, RGS 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B2X159
Sequence length 437
Comment (tr|A0A0B2X159|A0A0B2X159_9HYPO) Regulator of G protein signaling superfamily {ECO:0000313|EMBL:KHN98790.1} KW=Complete proteome; Reference proteome OX=1081103 OS=Metarhizium album ARSEF 1941. GN=MAM_03252 OC=Metarhizium.
Sequence
MGLYSLTYTRPKYVEQRGELSDEKTDGSVKSGRSGCSAGIPDSLGFDNMMNGGTCPPMTV
RDFMNYLIYVEHGAENLQFYLWYKDYVKRFHEANTADISLAPEWTQAMEDKAVAKIRKEQ
ARKMRSSPDAASIFRGTDFEKKAPGMPEKAVNPFNTPPQSSNGGSDKGSIDAASHSLPTA
TSYNSQAADAFQSAGARLPFTIQPFREEINRVIATYIMDEAPRQLNLASWEQKAAVQALS
HTTHPTAFRGLIKTVDASLRRQAHPNFVRWSICNGNPARVFFARFLGVFLIVAGFAIAIP
ITLSKLGRGYRAFAAVAWVLGISTLVAAYKGMCVVLHGMHHRHVRPWELFLQDDAEEPNK
RSFDSLGSENSYEDEPWVVKYEKRNVVRKVFDREVWIQEPALRQIQDTIFVQALLASVLL
GGALTAIFVAVPGGNFF
Download sequence
Identical sequences A0A0B2X159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]