SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2XKL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2XKL2
Domain Number 1 Region: 25-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000667
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B2XKL2
Sequence length 244
Comment (tr|A0A0B2XKL2|A0A0B2XKL2_LACCU) Uncharacterized protein {ECO:0000313|EMBL:KHO12474.1} KW=Complete proteome OX=28038 OS=Lactobacillus curvatus. GN=OA78_1632 OC=Lactobacillus.
Sequence
MFTAQPAIANVDLTAPRMIVDDPRIPMSYRALCQTTNGGFLTNFSLPTSEPTSDGLADVE
CHYLAGIAHNGEAVIQAPDLPDYLVPFSQHQQQYFVFDCQQASAEPPIRYIDTEVDQWLT
VADSLDSFLEQLGPKVIDLNPDNELTPLQRNHYLLVAQGAQLDTLLARYEADADKEWLFD
WLLYFAEHGTPAQQASALTAYDTQRLYFKHQLPRAKDAQLTALFEQLPHLKDAYHAHQQT
WSPL
Download sequence
Identical sequences A0A0B2XKL2
WP_039099178.1.49808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]