SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2XU17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2XU17
Domain Number 1 Region: 10-108
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000114
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B2XU17
Sequence length 114
Comment (tr|A0A0B2XU17|A0A0B2XU17_ACIBA) Uncharacterized protein {ECO:0000313|EMBL:KHO15390.1} KW=Complete proteome OX=470 OS=Acinetobacter baumannii. GN=NT90_10850 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MPLLNELKIKIESDFHRPLPDIYFQLLEFSDGILFESGVLIYSSNEVFERNQTFEVQKYA
EDYLAIGDDSGGMSILIPFRGEGVFVVDQGSMDPNDMSKISDSLMNWFKAGCQI
Download sequence
Identical sequences A0A0B2XU17 A0A1V2V6W4
WP_039252895.1.20652 WP_039252895.1.20686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]