SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B3A350 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B3A350
Domain Number 1 Region: 143-225
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000000702
Family Ribosomal proteins L24p and L21e 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B3A350
Sequence length 261
Comment (tr|A0A0B3A350|A0A0B3A350_9ARCH) Transcription elongation factor Spt5 {ECO:0000256|HAMAP-Rule:MF_00950} KW=Complete proteome; Reference proteome OX=1579365 OS=archaeon GW2011_AR3. GN=QS98_C0002G0086 OC=Archaea.
Sequence
MSDDFKKELEQLKKQHVDQKDEKQESAAPEKQESAKMSDKDEFAEMLDEISEPAKDKEAE
EEQAEKELPAKEVAVAPKAEVKQHIFALRTTANREDQVMDFVTSNAKKKKLDLYSVIRPH
GMRGYIFLEAPSRSDAEQSAFNVPYARGILPKEIDYSEIEHMLEQVKKEVNIRKNDIAEI
ISGPFKREKCKVTRIDKAKEEVVVELLEAAVPIPITVKMDAIKVIRRENEGEDADSDEQK
SIEVPPSVESSGTSGPEEDEF
Download sequence
Identical sequences A0A0B3A350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]