SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B3AAU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B3AAU2
Domain Number 1 Region: 146-266
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.49e-24
Family Archaeal tRNA CCA-adding enzyme substrate-binding domain 0.00044
Further Details:      
 
Domain Number 2 Region: 252-395
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 1.22e-16
Family Archaeal tRNA CCA-adding enzyme 0.013
Further Details:      
 
Domain Number 3 Region: 7-137
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000000115
Family Archaeal tRNA CCA-adding enzyme catalytic domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B3AAU2
Sequence length 414
Comment (tr|A0A0B3AAU2|A0A0B3AAU2_9ARCH) tRNA-NT {ECO:0000256|HAMAP-Rule:MF_01264} KW=Complete proteome; Reference proteome OX=1579365 OS=archaeon GW2011_AR3. GN=QS98_C0007G0012 OC=Archaea.
Sequence
MKKMGFLRDIADEIVPDMGIYKHVDAMLDRINSRIRKLKVRAKAVAGGSIAKNNFIRHDH
DIDLFVKFDKKYKSEELSDYLAKILSGMRAERIHGSRDYFRIRNGHNFEIVPVMDIRKGP
ESQNVTDMSPLHVNWVNAITRKNPKLLSEIRLTKQFCKAQGVYGAESYIRGFSGHVIDII
TLHYGGFLPLARNASKWKPGQVVDYHNVYKGKARQVLNESKLGPLIVIDPIMPERNASAA
LSEEKFQGFISACDRFLGNPSKQFFQIAKVTPETLRMKHKGKKVFCFSISLVDGKEDVVG
ARLARGVEFMSRQAEKYGFKLAASGFAYDRKTSGMAYFVMNNDALPSKMVLQGPPLASRE
HVARFKKVHRKTYVKGKSIYAIENRKMTKFSDYALFIARDKFFKDKIKKFQLAK
Download sequence
Identical sequences A0A0B3AAU2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]