SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B3AD86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B3AD86
Domain Number 1 Region: 2-128
Classification Level Classification E-value
Superfamily Ribosomal protein L13 1.57e-32
Family Ribosomal protein L13 0.0000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B3AD86
Sequence length 129
Comment (tr|A0A0B3AD86|A0A0B3AD86_9ARCH) 50S ribosomal protein L13, large subunit ribosomal protein L13 {ECO:0000313|EMBL:KHO48045.1} KW=Complete proteome; Reference proteome OX=1579367 OS=archaeon GW2011_AR5. GN=QT00_C0001G0057 OC=Archaea.
Sequence
MIIDGKNAVLGRLASYTAKKLLTGEEITIINAENIIITGRPNDIKTKYLAFKGRGSPQHG
PFFPRQPNMFVRRVIRGMLPKEKKGRDVLKNLKVYAGSNGMSGEQIAIKLIKTNYITVGE
LSKTLGWHK
Download sequence
Identical sequences A0A0B3AD86

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]