SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B3AT54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B3AT54
Domain Number 1 Region: 133-252
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 3.73e-28
Family Archaeal tRNA CCA-adding enzyme substrate-binding domain 0.001
Further Details:      
 
Domain Number 2 Region: 2-130
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.51e-19
Family Archaeal tRNA CCA-adding enzyme catalytic domain 0.012
Further Details:      
 
Domain Number 3 Region: 239-382
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 2.79e-17
Family Archaeal tRNA CCA-adding enzyme 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B3AT54
Sequence length 394
Comment (tr|A0A0B3AT54|A0A0B3AT54_9ARCH) tRNA-NT {ECO:0000256|HAMAP-Rule:MF_01264} OX=1579375 OS=archaeon GW2011_AR17. GN=QT08_C0018G0006 OC=Archaea.
Sequence
MKNLLKEIKPSRKEQQEVKKIIREIIKSIRIANTKVSLGGSSAKGTWLKNNHDIDIYIKF
NPKKYEGIDIAEVLKDNVQGTVLHGSRDYLQLKKGNYTVELIPIMEIKSVEHAQNITDIS
PFHAKWVNKHKKYKGDIMLAKAFAKANGFYGAESFIKGFSGYSMEVLTIHYKGFKKLLKN
VSQWKRTTVIDTEKHHKKKVQLNEAKMLSPIILVDPVQATRNVTAVVSPEKYDLFKKKAK
EYLKHPRKEMFVKKEFSLEELQKKKGEKIILELVPLEGKRDVVGAKLLKCFEYIKEQLKE
HDFVIKEANWHWKEGENAILYYIFKEQKLSPTIKHYGPPVKQKERLEHFKESWKQYPVKE
EKGRSYVMLSRKYSKPKDLMLQNLLGYLQNHMLS
Download sequence
Identical sequences A0A0B3AT54

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]