SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B3B1H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B3B1H1
Domain Number 1 Region: 3-123
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 4.32e-23
Family HEPN domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B3B1H1
Sequence length 126
Comment (tr|A0A0B3B1H1|A0A0B3B1H1_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:KHO54764.1} OX=1579377 OS=archaeon GW2011_AR19. GN=QT10_C0012G0012 OC=Archaea.
Sequence
MREEIKNLWEQTEKDFEVAEKNFKIKEYYVSAFFCQQSVEKTLKAFFMIKKGKSAGPTHS
LIYLAKETKIPSGFFGIFQDLSPEFVTTRYPDVAGDAPYKLYSKGKAQDYLIKSGRLIKW
IKQQIK
Download sequence
Identical sequences A0A0B3B1H1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]