SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B3WQY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B3WQY5
Domain Number 1 Region: 156-209
Classification Level Classification E-value
Superfamily R3H domain 0.000000392
Family R3H domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B3WQY5
Sequence length 212
Comment (tr|A0A0B3WQY5|A0A0B3WQY5_9FIRM) Single-stranded DNA-binding protein {ECO:0000313|EMBL:KHS56955.1} KW=Complete proteome; Reference proteome OX=1577792 OS=Terrisporobacter othiniensis. GN=QX51_10965 OC=Peptostreptococcaceae; Terrisporobacter.
Sequence
MQSQTKKIEIKSKTKEEAIQSALLELGVEEKDIEVKVIQNPSKGFLGFLGAKDGVYEVTV
IKKEEIEIAKEFIENILVNSKINAKVNATQKDNLIKISIEGKEATCLIGRRGETLDSVQF
LTGLALNKINKDSHMRVLVDIENYRNKREESLVRYARKVAREVAKTRRTKKLDYMNPYER
RIVHSALQNDKYVITYSEGTDPYRRLVIEYKR
Download sequence
Identical sequences A0A0B3WQY5
WP_039680030.1.43034 WP_039680030.1.71868 WP_039680030.1.84503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]