SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4CQK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4CQK0
Domain Number 1 Region: 46-115
Classification Level Classification E-value
Superfamily YdhG-like 0.000000051
Family YdhG-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4CQK0
Sequence length 145
Comment (tr|A0A0B4CQK0|A0A0B4CQK0_9MICO) Uncharacterized protein {ECO:0000313|EMBL:KIC58707.1} KW=Complete proteome OX=162426 OS=Microbacterium hominis. GN=RM52_05000 OC=Microbacterium.
Sequence
MSDTKSGFSADERAAMAQRAEELRSTKGLKGAAKLAAEFEACIAAIDALSGTDREVATLL
HRVVTEEAPQLAPKTWYGFPSYARDGKVVVFYQPASKFDTRYGTVGFQEDALLDDGDMWA
TSFAVVAVTPAVEKTLRELVARSVG
Download sequence
Identical sequences A0A0B4CQK0
WP_039413814.1.94560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]