SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4D4W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4D4W9
Domain Number 1 Region: 5-89
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 4.71e-18
Family PG0164-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4D4W9
Sequence length 158
Comment (tr|A0A0B4D4W9|A0A0B4D4W9_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:KIC61721.1} KW=Complete proteome; Reference proteome OX=363331 OS=Chryseobacterium taiwanense. GN=RM51_15080 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MKNQTVEFSTIIKQNGEMNAAFVVFPFSTEELFGKKGQVKIKALFDEKVEYRGSLAKMKS
DCYILGLTQAVRKQLNKTFGDNVLVSLTEDKEERTVEIADDIALVFTQNQEVKTLFDNMS
YTHRKEYIRWIEEAKKPETRENRKLKMIQMILDGKKGI
Download sequence
Identical sequences A0A0B4D4W9
WP_039371396.1.23484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]