SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4ENQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4ENQ7
Domain Number 1 Region: 352-463,505-527
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000131
Family Regulator of G-protein signaling, RGS 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B4ENQ7
Sequence length 542
Comment (tr|A0A0B4ENQ7|A0A0B4ENQ7_METAN) Regulator of G protein signaling superfamily {ECO:0000313|EMBL:KID59883.1} KW=Complete proteome OX=1276135 OS=Metarhizium anisopliae ARSEF 549. GN=MAN_10335 OC=Metarhizium.
Sequence
MGSEFGITPDTKPEVRLDGVGIFWIVFAVTWTVILISGMAFLWTKRDMPILRIRGLGLSF
TAIAFLHCYWVAVTTGYVYGPLMPEVAEFWIMSIWFPFGIALFHASNSRFLYVANAQKQY
VKKTGDLGWDGQRPRIRKTLVARWKMLPYTQRVLIFVGLGMVAHLSLTIFMFLISRKFHS
GWGISGTEVTGTAMEQKTEQGRGWEWWPSIFWQLFWAWVVAPVILWRSRNLRDTQGWRTQ
TIACCVSGLHASPMWLIALYVPGMAPVNNYFIPPQWIAIAIMMLEIFTVFIPVWEVRRQQ
SLCQETLDSIARWESRQKSVQHSGKSLHSGTSSSSWMGRTKAGSVSTTGGSILTMDALEH
TLAKNPEPLQEFSALRDFSGENIAFLTRVREWRAQYIVNPSLREPVRDEKDSEKTLTLSR
ECFESALRIYIDFISSNSAEFQVNLSSHDFKNLKAIFEGAARVVCGECSTPDPATPFADV
PKPQSESGETARYWGDIPEAFNEGVFDDSEMSIKYLVLTNTWPKFIRERRSFDGASSAEA
GK
Download sequence
Identical sequences A0A0A1V8M7 A0A0B4ENQ7 E9EXS3
XP_007821109.1.8330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]