SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4EYB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4EYB5
Domain Number 1 Region: 43-89,167-237
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.31e-18
Family Regulator of G-protein signaling, RGS 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B4EYB5
Sequence length 391
Comment (tr|A0A0B4EYB5|A0A0B4EYB5_METAN) Regulator of G protein {ECO:0000313|EMBL:KID60662.1} KW=Complete proteome OX=1276135 OS=Metarhizium anisopliae ARSEF 549. GN=MAN_09797 OC=Metarhizium.
Sequence
MYWPTWLTWYKKPEYRNIKEYSDAIRSGKRDYSPDRSGCVIPPKLRLDRVLGNKTCSPMS
LFDFYMYLKHIEFSEENLEFYMCAQGKRDCLGTSDNASPNTSTPHMSTPTETKHVDVSAG
AVERVLSQIRQLLGASATCTSGTKCKLTCVDDAESCEAGDDKLPEHSNSDDAYRDQVLAI
ARTFLLPGSPKELNIPCHMRTQVLADIQTSSHPSHLEPVADHVYQLLQHCSHRNFVRLGI
ANGTFETVCVATGLGIVLIVAGLLTVLLLAFTPSRGAHSPWTVFAAWPMLWLGMSLVLSG
LRGSCFFLLLFSRRQPLPWERFADEESGRLRRTARLGFLSRLMIFDNKLRVKDLHLRRLQ
HKIVIQSLVGGATFASLGVLLFIFLPVWRTS
Download sequence
Identical sequences A0A0B4EYB5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]