SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4F4G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4F4G8
Domain Number 1 Region: 365-461,509-531
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000412
Family Regulator of G-protein signaling, RGS 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B4F4G8
Sequence length 572
Comment (tr|A0A0B4F4G8|A0A0B4F4G8_METAN) Regulator of G protein signaling superfamily {ECO:0000313|EMBL:KID62672.1} KW=Complete proteome OX=1276135 OS=Metarhizium anisopliae ARSEF 549. GN=MAN_07888 OC=Metarhizium.
Sequence
MATPDLLHMSIYDMPTSPPLWDKVGRFYIGFCCTWTLLVLSGMAFCLVHRNNPALKIRGL
PLSFGSIILLHSYWVLAQITYPIGRSIPVILAYDIQYFFMGIYFPLGIALFHASNLRFLR
VARLQRQFTHGQSGHRLAPRCNGAKTSLLCRVRNMNYTARTMLFIGIAMVAQVLLTVGMW
FACKKYHPTYGLPGTQIKGDTLPEQLADLGRGWEWWPSVLWQVVWTWIVAPYLIWRAWGI
RDTMGWRTQTIACCLANLHATPMFLIASYLPAFEKVNVYFAPSQWIHLSIMIFEIFTVFV
PVFEVMSMWFVQKRVNQSNAKWDTASQFSSASQSFTLMGKGSTQSLYEKGRPLDYLDEEL
GDRLLTMTALDHVLKDNPGPLQEFSALNDFSGENVAFLTRVAKWKTSWPLMPAGEQKLDV
YNEALAIYTDFISPRDAEFPLNLSSRELKHLEDVFEKPARILCGEASANPATPFDIEAPM
PLNREVSHSDMAALAKYRGEIPAAFTLGVFDNVQSHIKYLVLTNTWPKFVSQMQSRRRSS
ETGRSMITDASGRSHGSRLSARLAKLLRDLGM
Download sequence
Identical sequences A0A0B4F4G8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]