SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4G2B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4G2B3
Domain Number 1 Region: 347-459,519-542
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000162
Family Regulator of G-protein signaling, RGS 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B4G2B3
Sequence length 570
Comment (tr|A0A0B4G2B3|A0A0B4G2B3_METAN) Regulator of G protein signaling superfamily {ECO:0000313|EMBL:KID62559.1} KW=Complete proteome OX=1276135 OS=Metarhizium anisopliae ARSEF 549. GN=MAN_07775 OC=Metarhizium.
Sequence
MGSEFGVTADSKKEANLDGVGIWWITWACVWTFVLLCGMGYLIHRRDTPILRIRGIGMSL
AAVVLLHLYFFSVQLGYVVGALAPGDCEYWIMGTYLPLGIAMFHASNSRFLYVAKVQKKY
LNRQVDGPAKSRRGMGVLDRFRSLNYTTRMVILVSMGMGFQLFLTILMWLISRKWHSGWG
IPGTEVYGTEMEQRMEMGRGWEWWPGIFWQFVWAWIIAPCVLWQSRNINDTHGWRLQTIG
CAVAGLHATPMWLIALYVPAMDPINKYFLPPQWICISILVLEILTVFLPCWEVVQASTLR
QETLDSIAQWERKNKNTGSSAKSVNTASTAIDSLMSGRKSTVGSVKSTDSQESILTMSAL
EYVLERNPTPLQEFSSLRDFSGENIAFLTSVAEWKTSLPQPVRDGVKDSTTGELIRERFN
SALRIYAEFISIKDAEFPINISSTELKRMEAVFEASARTLYGDKVEVDPATPFDFPEAAQ
KTSMETSSQASEKGRPAGTSYSDGVKFWGEIPESFDETVFDESEKHIKYLVLTNTWPKFV
KDRRVSIDMGASAERGPSIMSFVRSRRQKR
Download sequence
Identical sequences A0A0B4G2B3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]