SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4GHM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4GHM9
Domain Number 1 Region: 389-500
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.03e-28
Family DEP domain 0.0052
Further Details:      
 
Domain Number 2 Region: 528-680
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.36e-28
Family Regulator of G-protein signaling, RGS 0.0013
Further Details:      
 
Domain Number 3 Region: 215-340
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000114
Family PadR-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4GHM9
Sequence length 700
Comment (tr|A0A0B4GHM9|A0A0B4GHM9_9HYPO) Regulator of G protein signaling pathway {ECO:0000313|EMBL:KID79257.1} KW=Complete proteome OX=1276141 OS=Metarhizium brunneum ARSEF 3297. GN=MBR_00569 OC=Metarhizium.
Sequence
MAALSHRPPIEDDTPSQASKTHHRSHDNHHAHHTPPLKHYTSAPRSSTSDRLTADLTTLP
ASSHHQRHSSTPSASSFSRSQRSATSLLSRAAAALDRTQNAFAGISEPVIRPRHSNSALA
RLSLQSLSAPSPEPSSPGRTAGSKAFSVNGPFAPAPRAQIKVVSPAAQANHPPSQPYSET
DPSLPAPIRVAPSDKKMHQTSSRLLRMTDDDRPFTRDFKDLFATLIVSLLPLSAHRVRLS
KVEYTFLSEDAINNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKDMARSICQRFVE
ARFIESADGKYQQVYNMKGSVWQLTPKGITVLDRFCSRNGIQQKQVGELSNMSSAQLVIL
ERDQQTDKLLHDWGTIEVIFRRFVGADRRNVKTSVTAADSDSLHDYRDGLTGVKMAAERK
VNGKAYRDTFTGKATTDWLMDCSTIVDRRETVEIASLFVEYDLMEPVVQDRAFMSQNTGY
NLFQPTKHAIYQLTTRGKELISGSGSRGRASESENGTGSQRNGITRDSNTQRLEKILNDA
ALRLLFRENLRETHCEENLSFYKDVGEFVRSCKDAIRQAQKAPNASSMDTIKEIMAQAYG
IYNAFLAPGSPCELNIDHQLRNNLATRMTKAVGQDNTMIETLQEVTALFEDAQNAVFKLM
ASDSVPKFLRNAKYEQQLRNYDLDMSARAPERSQSRSNRK
Download sequence
Identical sequences A0A0B4GHM9
XP_014548395.1.23709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]