SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4GTB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4GTB5
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.06e-19
Family Regulator of G-protein signaling, RGS 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4GTB5
Sequence length 269
Comment (tr|A0A0B4GTB5|A0A0B4GTB5_9HYPO) Regulator of G-protein signaling {ECO:0000313|EMBL:KID90690.1} KW=Complete proteome OX=1276136 OS=Metarhizium guizhouense ARSEF 977. GN=MGU_02567 OC=Metarhizium.
Sequence
MATRPPTLTEILLDVSPPPWTLSAFMAYLSQNHCMETLEFTLDSQRYAAFYDQLAAENPP
SQESNARVCGLWDKLMEVYIVPCAPREVNIPARVRDRLLSLPSGPAAPHPAELEEAGRII
YELMNDSLLVPFLQSVAPLHFMGQNDDSSHHHHQQRRRSQNTAQHPDQPRRSVASPHSAD
FDSLTDDSDSNSPSGPELMTPPTTPPTSEYTFNSSPGGFQRAMAAHNKGWKKVGEKLGFS
RKTSSRRSTPTSSSSDYDAALGEPSHGHP
Download sequence
Identical sequences A0A0B4GTB5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]