SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4HT19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4HT19
Domain Number 1 Region: 27-98
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000000567
Family Subtilase propeptides/inhibitors 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B4HT19
Sequence length 99
Comment (tr|A0A0B4HT19|A0A0B4HT19_9HYPO) M protein repeat protein {ECO:0000313|EMBL:KIE02521.1} KW=Complete proteome; Reference proteome OX=1276143 OS=Metarhizium majus ARSEF 297. GN=MAJ_01555 OC=Metarhizium; Metarhizium majus.
Sequence
MKFLSSLVVALAALPAALAMNQKMPAIVYFSEDSTPDSVIEKAKKTLIEAGGKITHTYTI
IKGFAVIAPEKALQALQKVQAWGTDYGMTVEEDKGVTTQ
Download sequence
Identical sequences A0A0B4HFW7 A0A0B4HT19
XP_014581514.1.58995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]