SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4IB76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4IB76
Domain Number 1 Region: 176-236
Classification Level Classification E-value
Superfamily Chromo domain-like 1.1e-18
Family Chromo domain 0.00037
Further Details:      
 
Domain Number 2 Region: 55-125
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000000476
Family Chromo domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4IB76
Sequence length 250
Comment (tr|A0A0B4IB76|A0A0B4IB76_9HYPO) Heterochromatin protein one {ECO:0000313|EMBL:KIE03638.1} KW=Complete proteome; Reference proteome OX=1276143 OS=Metarhizium majus ARSEF 297. GN=MAJ_00169 OC=Metarhizium; Metarhizium majus.
Sequence
MPPALSDDESSDVGLQPTTRRSSRSSRSLADDARGTGSDDEPGPVAANGGSEVGEEDDEE
DEDLEEDVFIVEAIKSHMVDEDGSLRFQVKWEGYNSKKDLTWEPEENLEESAQEILDEYF
RSFGGRENIFNQTEKASRGKKRGRGASNAAAATAKRSRKNGTHPSDSAPPASAKPWQPPA
GSWEDEIATIDACEDEGSGKLVVYLIWKNGQKTKHETSVIYKKCPQKMLQFYERHVKIIR
DDERVAAQGD
Download sequence
Identical sequences A0A0B4IB76
XP_014582631.1.58995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]