SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4II65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4II65
Domain Number 1 Region: 52-94,207-280
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000314
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4II65
Sequence length 445
Comment (tr|A0A0B4II65|A0A0B4II65_9HYPO) Regulator of G protein signaling superfamily {ECO:0000313|EMBL:KIE00195.1} KW=Complete proteome; Reference proteome OX=1276143 OS=Metarhizium majus ARSEF 297. GN=MAJ_03852 OC=Metarhizium; Metarhizium majus.
Sequence
MGFLSLTYTRPQHVEQQSLQRSRESLSDENTDGSVKSGRSGHSAGIPDSLSFDNVMNGGT
CPPMTIRDFMNYLIYVEHSAENLQFYLWYKDYVKRFHEANAHDISLAPAWTQTMEDEAVA
KIRKEHATKTRSPPGAASIFRGTDFEKKVAEMPENALNPFNSPPQSSNGGSNKGSIDAAS
RTMPIAISGSYNSQAADAFQSAGARLPFTIQPFREEINRVIATYIMNGAPRQLNLASWEQ
KAAVQALSHTTHPTALRGIFRTVDSSLRQQAHPNFVRWSICNGNPARVLYARFLGVFLIV
AGFAIAIPITLSKLNRGYRAVAAIAWIFGISTLVAAYRGLCVVLHGMHHRHVRPWELFMQ
DDGEKPNKRSFDSFGTQNSYEDEPWVVKYKNRNVVRKVFDREVWIQEPALRQIQDTIFVQ
ALLASVLLSVVLAAIFVAVPQGHLF
Download sequence
Identical sequences A0A0B4II65
XP_014579188.1.58995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]