SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4IJJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4IJJ2
Domain Number 1 Region: 16-100
Classification Level Classification E-value
Superfamily t-snare proteins 2.51e-22
Family t-snare proteins 0.00072
Further Details:      
 
Domain Number 2 Region: 136-195
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000000000205
Family SNARE fusion complex 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B4IJJ2
Sequence length 211
Comment (tr|A0A0B4IJJ2|A0A0B4IJJ2_9HYPO) SNARE complex subunit protein {ECO:0000313|EMBL:KIE02580.1} KW=Complete proteome; Reference proteome OX=1276143 OS=Metarhizium majus ARSEF 297. GN=MAJ_01614 OC=Metarhizium; Metarhizium majus.
Sequence
MSNPLDTEAGSELFSSYEAELKLVQADLLQKLDQIPELSGDPRKNAVSQAERALEEADEL
LGSMRLEKQNIPTSSRAKVNQRFRNYEQDVDSQRRKLKSFSNDHQGYASRYRDEPEGSTD
AHLEQRQQLLSGTDRLDRSTQRLKASQQLAYDTEAIGASTLADLSSQRERIQQTHETLLN
SEGYVDRSVKTLRGMAPCIRANSEAFQDGYE
Download sequence
Identical sequences A0A0B4IJJ2
XP_014581573.1.58995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]