SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4K7N2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4K7N2
Domain Number 1 Region: 61-185
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.15e-36
Family Regulator of G-protein signaling, RGS 0.00013
Further Details:      
 
Domain Number 2 Region: 368-456
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.59e-30
Family Ras-binding domain, RBD 0.0026
Further Details:      
 
Domain Number 3 Region: 313-381
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000028
Family Ubiquitin-related 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B4K7N2
Sequence length 782
Comment (tr|A0A0B4K7N2|A0A0B4K7N2_DROME) Locomotion defects, isoform F {ECO:0000313|EMBL:AFH06559.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG5248 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MNASDNDMYIKTLMLDSDLKSSRSQHQLSLLQVPKVLTTPAPPSAITASVAAEGAAQDHG
CPSSWAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLESEADRVAQAREI
FAKHLANNSSDPVNVDSQARSLTEEKLADAAPDIFAPAQKQIFSLMKFDSYQRFIRSDLY
KSCVEAEQKNQPLPYSGLDLDELLKTNFHLGAFSKLKKSASNAEDRRRKSLLPWHRKTRS
KSRDRTEIMADMQHALMPAPPVPQNAPLTSASLKLVCGQNSLSDLHSSRSSLSSFDAGTA
TGGQGASTESVYSLCRVILTDGATTIVQTRPGETVGELVERLLEKRNLVYPYYDIVFQGS
TKSIDVQQPSQILAGKEVVIERRVAFKLDLPDPKVISVKSKPKKQLHEVIRPILSKYNYK
MEQVQVIMRDTQVPIDLNQPVTMADGQRLRIVMVNSDFQVGGGSSMPPKQSKPMKPLPQG
HLDELTNKVFNELLASKADAAASEKSRPVDLCSMKSNEAPSETSSLFERMRRQQRDGGNI
PASKLPKLKKKSTSSSQQSEEAATTQAVADPKKPIIAKLKAGVKLQVTERVAEHQDELLE
GLKRAQLARLEDQRGTEINFDLPDFLKNKENLSAAVSKLRKVRASLSPVSKVPATPTEIP
QPAPRLSITRSQQPVSPMKVDQEPETDLPAATQDQTEFAKAPPPLPPKPKVLPIKPSNWG
VAQPTGNYCNKYSPSKQVPTSPKEASKPGTFASKIPLDLGRKSLEEAGSRCAYLDEPSSS
FV
Download sequence
Identical sequences A0A0B4K7N2
FBpp0293211 NP_001247241.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]