SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4KZC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4KZC5
Domain Number 1 Region: 25-129
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 3.4e-40
Family Chemosensory protein Csp2 0.0000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B4KZC5
Sequence length 130
Comment (tr|A0A0B4KZC5|A0A0B4KZC5_9CUCU) Chemosensory protein 9 {ECO:0000313|EMBL:AHE13804.1} OX=308863 OS=Lissorhoptrus oryzophilus (rice water weevil). GN= OC=Cucujiformia; Brachyceridae; Erirhininae; Lissorhoptrus.
Sequence
MNSATLTCILVILILNICYGADEKYTNKYDNINIDEILQSDRLLNNYMNCLLDKGRCTPD
GAELKKNLPDALEDECSKCSEYQKDRGRKALKFLIEKRRGYFDQLEAKYDPDGKYRKRYE
ENMKKEGITL
Download sequence
Identical sequences A0A0B4KZC5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]