SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4VMT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4VMT2
Domain Number 1 Region: 124-282
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 3.34e-80
Family Retrovirus capsid protein, N-terminal core domain 0.0000000571
Further Details:      
 
Domain Number 2 Region: 2-129
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 2.47e-61
Family Immunodeficiency virus matrix proteins 0.00000169
Further Details:      
 
Domain Number 3 Region: 273-355
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.33e-33
Family Retrovirus capsid protein C-terminal domain 0.000016
Further Details:      
 
Domain Number 4 Region: 370-421
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 6.4e-18
Family Retrovirus zinc finger-like domains 0.0000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4VMT2
Sequence length 491
Comment (tr|A0A0B4VMT2|A0A0B4VMT2_9HIV1) Gag polyprotein {ECO:0000256|RuleBase:RU004487, ECO:0000256|SAAS:SAAS00998370} OX=11676 OS=Human immunodeficiency virus 1. GN=gag OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MGARASILRGGKLDKWEKIRLRPGGKKHYQLKHLVWASRELERFALNPGLLETSEGCKQI
MKQLQPALKTGTEEIRSLYNTVATLYCVHTGVDVQDTKEALDKIEEEQNKMQQEKEADGK
VSQNYPIVQNIQGQMVHQPISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTM
LNTVGGHQAAMQILKDTINEEAAEWDRLHPVHAGPNAPGQMREPRGSDIAGTTSTLQEQI
AWMTGNPPVPVGDIYKRWIILGLNKIVRMYSPTSILDIKQGPKEPFRDYVDRFFKTLRAE
QATQDVKNWMTDTLLVQNANPDCKTILRALGPGASIEEMMTACQGVGGPSHKARVLAEAM
SQTQSAIMMQRSNFKGPKRNVKCFNCGKEGHIARNCRAPRKKGCWKCGKEGHQMKDCTER
QANFLGKIWPSHKGRPGNFLQSRPEPTAPPEESFRFGGETTTPSQKQEPLDKELYPLASL
KSLFGNDPSSQ
Download sequence
Identical sequences A0A0B4VMT2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]