SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4ZYN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4ZYN2
Domain Number 1 Region: 46-116
Classification Level Classification E-value
Superfamily Serpins 0.00000000131
Family Serpins 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B4ZYN2
Sequence length 121
Comment (tr|A0A0B4ZYN2|A0A0B4ZYN2_RHIMP) Rhipicephalus microplus putative serpin S-21 mRNA {ECO:0000313|EMBL:AJD80365.1} OX=6941 OS=Rhipicephalus microplus (Cattle tick) (Boophilus microplus). GN= OC=Rhipicephalus; Boophilus.
Sequence
CLKTLELHRSSSPTDVSGSAPNAVAPGGLNASKAPSKAESVSSSANVQDLRVEGLYHKAS
LDLTTKGGPSPPGFSTLLSVCSTIPPNEPVRFVVDRPFVFAVLAEGLLLMIGLVRNVQSN
V
Download sequence
Identical sequences A0A0B4ZYN2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]