SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5AMN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5AMN5
Domain Number 1 Region: 139-277
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.18e-45
Family AadK C-terminal domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 1-136
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.58e-43
Family AadK N-terminal domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B5AMN5
Sequence length 288
Comment (tr|A0A0B5AMN5|A0A0B5AMN5_9BACL) Aminoglycoside 6-adenylyltransferase {ECO:0000313|EMBL:AJD89798.1} KW=Complete proteome; Reference proteome OX=1508404 OS=Jeotgalibacillus malaysiensis. GN=JMA_04810 OC=Jeotgalibacillus.
Sequence
MRSEQEMMALILGFAREDSRIKAVYMNGSRTNPNAPRDMFQDYDIVYVTDEMEGFTADQS
WISYFGNLLMMQQPDALDAGKGLSTDPGRYAFLMLFDDGNRIDLSFQTVDYMQKVYLNDS
LTIPLLDKDGILPDIPESTDRDYFVKKPSEGEFDSVTNDFWWCLQNVAKGLWRDELPYAH
HMFELTTRSALDQMIEWWIGSQHDYEVSAGKMGKYFKRFLPEEYWTTYLKTYAEDKWAAV
DTAAELFGQIGREVAEKEGFQYPERDEKQMLMFVRRVRSLPGDAEAIF
Download sequence
Identical sequences A0A0B5AMN5
WP_039806845.1.69373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]