SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5AQ50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5AQ50
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 6.28e-37
Family Family 1 bi-partite nucleotidyltransferase subunit 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B5AQ50
Sequence length 107
Comment (tr|A0A0B5AQ50|A0A0B5AQ50_9BACL) Uncharacterized protein {ECO:0000313|EMBL:AJD92335.1} KW=Complete proteome; Reference proteome OX=1508404 OS=Jeotgalibacillus malaysiensis. GN=JMA_30180 OC=Jeotgalibacillus.
Sequence
MDRKLKKNFDNLSLALSRLEEALAEDSSNSLIVDGTIQRFEFTIELYWKTLKRCLQSEGI
EAKTPRETLKEAYKAEWLNDEQAWLQMLKDRNETSHTYNEELAREIL
Download sequence
Identical sequences A0A0B5AQ50
WP_082029108.1.69373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]