SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5ASJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5ASJ4
Domain Number 1 Region: 10-91
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 5.23e-32
Family Ribosomal L27 protein 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B5ASJ4
Sequence length 96
Comment (tr|A0A0B5ASJ4|A0A0B5ASJ4_9BACL) 50S ribosomal protein L27 {ECO:0000256|HAMAP-Rule:MF_00539} KW=Complete proteome; Reference proteome OX=1508404 OS=Jeotgalibacillus malaysiensis. GN=JMA_23300 OC=Jeotgalibacillus.
Sequence
MLRLDLQFFASKKGVGSTKNGRDSISKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVG
RGGDDTLFAKADGVVRFERMGRDKKKVSVYPAAQEA
Download sequence
Identical sequences A0A0B5ASJ4 A0A0C2RSZ4
WP_039810086.1.28990 WP_039810086.1.69373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]