SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5CRX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5CRX5
Domain Number 1 Region: 28-98,125-188
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000109
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B5CRX5
Sequence length 205
Comment (tr|A0A0B5CRX5|A0A0B5CRX5_NEIEG) Glucan synthase {ECO:0000313|EMBL:AJE19041.1} KW=Complete proteome; Reference proteome OX=546263 OS=Neisseria elongata subsp. glycolytica ATCC 29315. GN=NELON_09120 OC=Neisseriaceae; Neisseria.
Sequence
MKQLIDRINAQLERLKRQYPEASVRHEADFSLNKGAGEADFAELEKEPGYALPEDFKELY
RIADGEAGQEVVLAGEEWLSVRRIIEEYRIWKQLYEEGLFAEDDGTPFGCEPEDAGIKPD
LWWNSKWIPLTADGCGNGKMIDLDPTGNGTAGQIIQMWHDDPICSKEADSLYGFFARYAQ
DLEDGKYVLSADYGLILQSELDELA
Download sequence
Identical sequences A0A0B5CRX5
WP_041961479.1.10680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]