SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5D645 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5D645
Domain Number 1 Region: 31-252
Classification Level Classification E-value
Superfamily Sortase 3.66e-42
Family Sortase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B5D645
Sequence length 268
Comment (tr|A0A0B5D645|A0A0B5D645_9CORY) Sortase {ECO:0000313|EMBL:AJE34301.1} KW=Complete proteome; Reference proteome OX=1223515 OS=Corynebacterium humireducens NBRC 106098 = DSM 45392. GN=B842_12280 OC=Corynebacterium.
Sequence
MSNRTDNPRRRVSVSQVLGELLLTAGVIVMLFAFYESYWTNIAAGKLQDEKASALEARWG
GDGERVNPRQRLTPELGEAFARMYVPAFGSDFQFAIVEGTSDEDLNAGPGRYVDTQMPGE
PGNFAVAGHRVGKGAPFNDLGNLKVCDAVVVETQTEWITYRVLPIDAVGDARRAEATGCL
TPEQVERITTGEYAGVQGRHITLPGAVEVINPVPGLAATQVDESMESLITLTTCHPQFSN
AERMIVHAIEVESTPKIAGQRPAVLEEK
Download sequence
Identical sequences A0A0B5D645
WP_040087005.1.13638 WP_040087005.1.36324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]