SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5DAX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5DAX1
Domain Number 1 Region: 19-80
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000235
Family SMI1/KNR4-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B5DAX1
Sequence length 205
Comment (tr|A0A0B5DAX1|A0A0B5DAX1_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:AJE40743.1} KW=Complete proteome; Reference proteome OX=40318 OS=Streptomyces nodosus. GN=SNOD_12255 OC=Streptomyces.
Sequence
MKPLLSLVSPAHGADEQVDWQAAEEALGAGLPSDYKAFMSVYGAGDIGELGILGPLPVDY
VQWDPGNVLDATPGFRGLWDSEGGVPGVTADSSVVLPWGSGCNANELGWLTLDPDPDKWP
VVAWRRQIRYGDSRWKLFDCGMVDFLVRMMRADFDECPLGDASLWGEAAPFVHWREQQRR
WLAGLDPETGEPTPLVQDFLQWPAS
Download sequence
Identical sequences A0A0B5DAX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]