SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5DBN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5DBN0
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 1.05e-30
Family Ribosomal L27 protein 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B5DBN0
Sequence length 84
Comment (tr|A0A0B5DBN0|A0A0B5DBN0_9ACTN) 50S ribosomal protein L27 {ECO:0000256|HAMAP-Rule:MF_00539} KW=Complete proteome; Reference proteome OX=40318 OS=Streptomyces nodosus. GN=SNOD_11780 OC=Streptomyces.
Sequence
MAHKKGASSTRNGRDSNAQRLGVKRFGGQVVNAGEILVRQRGTHFHPGAGVGRGGDDTLF
ALQAGAVQFGTHRGRNVVNIVPVA
Download sequence
Identical sequences A0A0B5DBN0
WP_043440182.1.62098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]