SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5DI47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5DI47
Domain Number 1 Region: 5-151
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000222
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B5DI47
Sequence length 194
Comment (tr|A0A0B5DI47|A0A0B5DI47_9ACTN) Molybdenum cofactor biosysnthesis protein MoeA {ECO:0000313|EMBL:AJE40860.1} KW=Complete proteome; Reference proteome OX=40318 OS=Streptomyces nodosus. GN=SNOD_12975 OC=Streptomyces.
Sequence
MRSAWGRIVHWLEANAPASAQALCGPATDGDIASLHEALGLDVPDALEALLRMNNGSTAK
DTKQVLSSGRVLPVRHPDAALFPAGMVLLGCAEIAEQYAKWRRSEEEHGIEGYWGASWVP
VVQDFEGQYYGFAVDASGASSGFPVLEYGEGSLPGEASPSLGTLLDTFADALQRGRWDGW
PARVERGSLRWGEE
Download sequence
Identical sequences A0A0B5DI47
WP_043448520.1.62098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]