SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5DUT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5DUT8
Domain Number 1 Region: 20-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000759
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B5DUT8
Sequence length 199
Comment (tr|A0A0B5DUT8|A0A0B5DUT8_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:AJE43947.1} KW=Complete proteome; Reference proteome OX=40318 OS=Streptomyces nodosus. GN=SNOD_31100 OC=Streptomyces.
Sequence
MTDYLPAVMAMLGQAQNRYANPSAWDRLHAELGIRLPTDYQTLVDAYAPIQLNGHLSLPH
PATTRWNLGDWIRDTARAWSEVSWEDLDPDEDPRLLFGLTELSFGTRNGLWPIASTDRGE
TLFLMAADGMLSGILVEDGEGGWAQYEMSFAEWLYRYLVGEDMAGPNTSAFYPGPVQLRR
LPMTADERPERWSGPERGM
Download sequence
Identical sequences A0A0B5DUT8
WP_043446554.1.62098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]