SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5HWZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5HWZ5
Domain Number 1 Region: 136-258
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 9.1e-29
Family Archaeal tRNA CCA-adding enzyme substrate-binding domain 0.00033
Further Details:      
 
Domain Number 2 Region: 3-134
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.21e-19
Family Archaeal tRNA CCA-adding enzyme catalytic domain 0.012
Further Details:      
 
Domain Number 3 Region: 245-397
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 8.63e-18
Family Archaeal tRNA CCA-adding enzyme 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B5HWZ5
Sequence length 405
Comment (tr|A0A0B5HWZ5|A0A0B5HWZ5_9ARCH) tRNA-NT {ECO:0000256|HAMAP-Rule:MF_01264} KW=Complete proteome; Reference proteome OX=1579378 OS=archaeon GW2011_AR20. GN=QT11_C0001G0691 OC=Archaea.
Sequence
MDIINKISPSKKEREAVNKVIDKFLKKLKSRLKECELLIGGSMGKDSWLSGDHDVDIFVK
FPKGYHKRDISKILQERLKNIKFNLVHGSRDYLQINKGNYLFEIIPVINIKKHEDALNIT
DVSPLHVTWVKKNAKNHNEIRLTKAFLKANNLYGAESYKKSFSGYVVELLTIYYGNFNNL
VVEASDWKEPVVIDIERYYKNKKELLTNLNKDKLSSLILIDPVQPDRNAAASLSREKFNE
FIGLCNRYLRNPSEKFFVEKKFDLNGLKNKYKKYDIILLKAKELEGKEDVVGGKLLKAFN
YVKERIIKEGWKVKEANWEWNNEVLFYYVVERKKLSKDVIHFGPPKKLSEHVEQFRKRWK
NYRVFNDTYHVYVKLKRKHRDIKPSVKNLIKDKYLKNLVKDIKVK
Download sequence
Identical sequences A0A0B5HWZ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]